PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00073.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 370aa    MW: 42254.7 Da    PI: 7.041
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00073.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.1e-1184116335
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                              ++k +rr+++NReAA++sR+RKka++++Le+  
  Rsa1.0_00073.1_g00017.1  84 PDKIQRRLAQNREAAKKSRLRKKAYVQHLETSR 116
                              6899*************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.2E-682145IPR004827Basic-leucine zipper domain
PfamPF001701.4E-884114IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-786120No hitNo description
Gene3DG3DSA:1.20.5.1703.4E-787127No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
PfamPF141441.2E-29172247IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MNSTTTHFVP PRRVGIYEPL HQFGMWGETF KNNIGNGGDM NSPSHIIIPN YQQIENNNLS  60
EDTSHGTGGT PHMFDQEAST SRHPDKIQRR LAQNREAAKK SRLRKKAYVQ HLETSRLKLI  120
HLEQELDRAR QQGFYVGNGI DTNSIGFSEP MNPGIATFEM EYGHWIQEQN NQICELRTVL  180
QGQVSDVELR LLVETAMKHY FDLFRMKSAA AKEDVFFVMS GMWRTSAERF FLWIGGFRPS  240
DLLKVLLPHF DVMTDQQILD VCNLRQSCQQ AEDALSQGME KLQHTLADCV AGGRLGEGSY  300
IPQVNSAMER LEALVSFVNQ ADHLRHEALQ QMNRILTTRQ AARGLLALGE YFQRLRALSS  360
SWATRDREQT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013678434.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_013678435.10.0PREDICTED: transcription factor TGA1-like
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A078H5Z10.0A0A078H5Z1_BRANA; BnaC02g43620D protein
STRINGBra031871.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein